PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_9901_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 372aa    MW: 42669.3 Da    PI: 8.6939
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_9901_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF72.82.8e-23955147
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                   k+ienk+ r++tf+kR+ g+ KKA+ELS+LCd+eva++ifs+ gkl 
  Neem_9901_f_2  9 KKIENKTYRHITFAKRKIGLVKKAYELSTLCDVEVALVIFSPAGKLI 55
                   68*******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.2E-29160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.156161IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.15E-25278IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-21323IPR002100Transcription factor, MADS-box
PfamPF003192.0E-221055IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-212338IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-213859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MGRVRLQLKK IENKTYRHIT FAKRKIGLVK KAYELSTLCD VEVALVIFSP AGKLILFDGK  60
KRLEEIFTRY IDLPHHQRGR LRDHELVRRI IIQMSLEAEL RHRLSSYGNS DRENKMSIDS  120
QLEEIQNKIR TYSAELEDVE KKLQYFLKSP SSIKSASEAE FLEGILEDTN LKIFENIYDN  180
IDFVRYFLKS PSSIKSASEA EFLEGILEDT LKLVRFHKHD LEARNNMQLV SERQPSLHQQ  240
SIGSNSFIMG SSNYCLENWP QKYAANQVLT ANKFSHSTGF QSFMRNNQSQ PVAEMPPSSM  300
PNLFGTGYPT ANIVVSRAGP EFFSANFPQV FNTNQEGRRS DNNEQNKVVD TTVASNRSCS  360
QYGDGHGMPF PY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P7e-15178179Myocyte-specific enhancer factor 2B
1tqe_Q7e-15178179Myocyte-specific enhancer factor 2B
1tqe_R7e-15178179Myocyte-specific enhancer factor 2B
1tqe_S7e-15178179Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015388552.15e-77PREDICTED: uncharacterized protein LOC107178187
TrEMBLA0A061DGV63e-66A0A061DGV6_THECC; Transmembrane isoform 1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17254910
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.16e-34AGAMOUS-like 104